PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0609s0180.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Whirly
Protein Properties Length: 305aa    MW: 33653.1 Da    PI: 9.9069
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0609s0180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly211.58.9e-661272651139
                  Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsne 87 
                             s+yk+kaal+v+++ p+f+ ldsg+ kl ++G++ll++a+a+a+r+ydW +kq+f+ls+te+++lv+l++k+sceffhdp +++s+e
  SapurV1A.0609s0180.1.p 127 SIYKGKAALTVEPRSPEFSPLDSGAYKLVKEGFVLLQFAPAAAVRQYDWTRKQVFSLSVTEIGHLVSLGPKDSCEFFHDPNKGKSEE 213
                             7************************************************************************************** PP

                  Whirly  88 GkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                             Gkvrk lkvePlpdGsG+f+nlsv+n++++ +es+++Pv+kae++vl s+++
  SapurV1A.0609s0180.1.p 214 GKVRKLLKVEPLPDGSGHFFNLSVQNKVLNIDESIYIPVTKAEYTVLTSAFN 265
                             ************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.108.9E-78115287IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544474.08E-76120304IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.4E-60128262IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGLWSMDGSI NLSTSILYPS SPSSLSVPGS TKKREERGKM LQLNNVSRVS STPQNPKLWL  60
LQSNSPCPQK SIAFNSKTSS TEKKKTLGVR CQFYDQQHKN FTTSSRSSPS FAPPAGESAP  120
KLFVGHSIYK GKAALTVEPR SPEFSPLDSG AYKLVKEGFV LLQFAPAAAV RQYDWTRKQV  180
FSLSVTEIGH LVSLGPKDSC EFFHDPNKGK SEEGKVRKLL KVEPLPDGSG HFFNLSVQNK  240
VLNIDESIYI PVTKAEYTVL TSAFNYILPY LLGWHAYANS IKPDDSSRGN NASPRYGGDH  300
EWNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-11211630332219p24: plant transcriptional regulator PBF-2
1l3a_B1e-11211630332219p24: plant transcriptional regulator PBF-2
1l3a_C1e-11211630332219p24: plant transcriptional regulator PBF-2
1l3a_D1e-11211630332219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1464070.0EF146407.1 Populus trichocarpa clone WS0117_P12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311601.11e-170hypothetical protein POPTR_0008s14840g
SwissprotQ9M9S31e-115WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA9PDN01e-170A9PDN0_POPTR; Uncharacterized protein
STRINGPOPTR_0008s14840.11e-170(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-113ssDNA-binding transcriptional regulator